Web Analysis for Garfieldheightscertifiedchimneysweep - garfieldheightscertifiedchimneysweep.com
R Chimney Sweep - R Chimney Sweep is a Certified Chimney Sweep in Garfield Heights, OH
garfieldheightscertifiedchimneysweep.com is 4 years 4 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, garfieldheightscertifiedchimneysweep.com is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 2 | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | 2 | Total Images: | 9 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 52.44.94.227)
LaRoux Artistry is a Makeup Service in Los Angeles, CA
LaRoux Artistry - LaRoux Artistry is a Makeup Service in Los Angeles, CA
Los Animales Food Truck is a Taco Stand in Los Angeles, CA
Los Animales Food Truck - Los Animales Food Truck is a Taco Stand in Los Angeles, CA
Emanuel Air Systems, Inc. is an HVAC Company in Houston, TX
Emanuel Air Systems, Inc. - Emanuel Air Systems, Inc. is an HVAC Company in Houston, TX
Kool Kutz is a Barber Shop in Fort Lauderdale, FL
Kool Kutz - Kool Kutz is a Barber Shop in Fort Lauderdale, FL
T&K Auto Collision, LLC is a Mechanic in Tampa, FL
T&K Auto Collision, LLC - T&K Auto Collision, LLC is a Mechanic in Tampa, FL
HTTP Header Analysis
Server: openresty
Date: Mon, 06 Jan 2020 07:54:04 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Content-Encoding: gzip
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns73.domaincontrol.com | 97.74.106.47 | United States of America | |
ns74.domaincontrol.com | 173.201.74.47 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
garfieldheightscertifiedchimneysweep.com | A | 599 |
IP: 52.44.94.227 |
garfieldheightscertifiedchimneysweep.com | NS | 3600 |
Target: ns73.domaincontrol.com |
garfieldheightscertifiedchimneysweep.com | NS | 3600 |
Target: ns74.domaincontrol.com |
garfieldheightscertifiedchimneysweep.com | SOA | 600 |
MNAME: ns73.domaincontrol.com RNAME: dns.jomax.net Serial: 2019123000 Refresh: 28800 Retry: 7200 Expire: 604800 Minimum TTL: 600 |
garfieldheightscertifiedchimneysweep.com | TXT | 600 |
TXT: google-site-verification=abQyygD2N8V4uDK T0_vEqYuwPmTf8fSacm-P-SHQpZU |
Full WHOIS Lookup
Registry Domain ID: 2466172697_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-12-11T22:26:24Z
Creation Date: 2019-12-11T22:26:23Z
Registrar Registration Expiration Date: 2020-12-11T22:26:23Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Registrant Street: DomainsByProxy.com
Registrant Street: 14455 N. Hayden Road
Registrant City: Scottsdale
Registrant State/Province: Arizona
Registrant Postal Code: 85260
Registrant Country: US
Registrant Phone: +1.4806242599
Registrant Phone Ext:
Registrant Fax: +1.4806242598
Registrant Fax Ext:
Registrant Email: garfieldheightscertifiedchimneysweep.com@domainsbyproxy.com
Registry Admin ID: Not Available From Registry
Admin Name: Registration Private
Admin Organization: Domains By Proxy, LLC
Admin Street: DomainsByProxy.com
Admin Street: 14455 N. Hayden Road
Admin City: Scottsdale
Admin State/Province: Arizona
Admin Postal Code: 85260
Admin Country: US
Admin Phone: +1.4806242599
Admin Phone Ext:
Admin Fax: +1.4806242598
Admin Fax Ext:
Admin Email: garfieldheightscertifiedchimneysweep.com@domainsbyproxy.com
Registry Tech ID: Not Available From Registry
Tech Name: Registration Private
Tech Organization: Domains By Proxy, LLC
Tech Street: DomainsByProxy.com
Tech Street: 14455 N. Hayden Road
Tech City: Scottsdale
Tech State/Province: Arizona
Tech Postal Code: 85260
Tech Country: US
Tech Phone: +1.4806242599
Tech Phone Ext:
Tech Fax: +1.4806242598
Tech Fax Ext:
Tech Email: garfieldheightscertifiedchimneysweep.com@domainsbyproxy.com
Name Server: NS73.DOMAINCONTROL.COM
Name Server: NS74.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-01-06T07:00:00Z <<<
For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en
Notes:
IMPORTANT: Port43 will provide the ICANN-required minimum data set per
ICANN Temporary Specification, adopted 17 May 2018.
Visit https://whois.godaddy.com to look up contact data for domains
not covered by GDPR policy.
The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.
Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.